vodafone rufnummernmitnahme gutschrift

"actions" : [ ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "event" : "MessagesWidgetEditAnswerForm", "context" : "", })(LITHIUM.jQuery); "eventActions" : [ } }); "context" : "", "useSimpleView" : "false", "action" : "rerender" if ( count == neededkeys.length ) { { ] "action" : "rerender" return true; { "displayStyle" : "horizontal", "componentId" : "kudos.widget.button", "context" : "", "event" : "AcceptSolutionAction", }, "disableLabelLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); } "truncateBody" : "true", { ] }, "context" : "", "action" : "rerender" "action" : "rerender" "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_205eb82d46fc9e', 'disableAutoComplete', '#ajaxfeedback_205eb82c8d45a1_0', 'LITHIUM:ajaxError', {}, 'fukCtvLOXG_hmvAr3oVBdbGo8PM_4iyLBV14XWnpBnA. { "selector" : "#messageview_5", Die Gutschrift wird gegen die gesamte Mobilfunkrechnung gebucht, bis diese aufgebraucht ist. "context" : "envParam:quiltName,product,contextId,contextUrl", { watching = false; "context" : "", } } "eventActions" : [ { }, }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '6wZEhQYzxMp2iURY53o9Pd1c48Nq4WPf8Awn_ra7FHM. "action" : "rerender" "revokeMode" : "true", { ] LITHIUM.Dialog.options['-1251036046'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "revokeMode" : "true", } Hier gibt's alle Infos zum Preis und unseren Zukunftsplänen! "event" : "RevokeSolutionAction", "action" : "rerender" }); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { })(LITHIUM.jQuery); }, "event" : "deleteMessage", "action" : "rerender" } ;(function($) { watching = false; "action" : "rerender" "event" : "ProductAnswer", "context" : "envParam:quiltName", Bist du sicher, dass du fortfahren möchtest? "kudosLinksDisabled" : "false", // Set start to true only if the first key in the sequence is pressed } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); { }, { "useTruncatedSubject" : "true", { "revokeMode" : "true", } "event" : "markAsSpamWithoutRedirect", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "context" : "envParam:entity", } { "event" : "removeMessageUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { $(document).keydown(function(e) { { } "actions" : [ "revokeMode" : "true", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "event" : "QuickReply", "event" : "MessagesWidgetCommentForm", // We made it! "triggerEvent" : "click", }, }, "initiatorBinding" : true, }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); }, }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "approveMessage", { }, "action" : "rerender" }, "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] { "actions" : [ "componentId" : "forums.widget.message-view", } ] } else { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); { { LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. disableInput(pagerId); "context" : "", } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "action" : "rerender" $(document).ready(function(){ "disableKudosForAnonUser" : "false", $(document).ready(function(){ "disallowZeroCount" : "false", }, } }, "event" : "MessagesWidgetMessageEdit", "actions" : [ { } > 0) ) "actions" : [ $(this).next().toggle(); "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "", "actions" : [ { "context" : "envParam:quiltName", "disallowZeroCount" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog.options['1936813668'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; lithstudio: [], { "entity" : "1999487", if (isNaN(val) ) { "actions" : [ watching = false; { "event" : "QuickReply", }); "action" : "rerender" "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "actions" : [ ] }, ] "actions" : [ { "componentId" : "forums.widget.message-view", }, "initiatorBinding" : true, ] LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName", }, "actions" : [ "selector" : "#messageview_3", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "event" : "kudoEntity", $(document).ready(function(){ "event" : "MessagesWidgetEditAction", "actions" : [ }, ] "actions" : [ "}); } else { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1622795 .lia-rating-control-passive', '#form'); } "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/63406","ajaxErrorEventName":"LITHIUM:ajaxError","token":"02z5UE60TMDU8jqpI9hawOEDs9wJ87n_acTLQkuX1S8. return; }, "parameters" : { "event" : "unapproveMessage", "actions" : [ "context" : "", "action" : "rerender" "actions" : [ "componentId" : "kudos.widget.button", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, }, "context" : "envParam:quiltName", "event" : "AcceptSolutionAction", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", return; } "kudosLinksDisabled" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'NexndCIdS6enisOrVgPfm1dyjTQDl4SdK6Ab38GcttA. "action" : "rerender" "componentId" : "kudos.widget.button", ] }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { "revokeMode" : "true", } }, "action" : "rerender" { element.siblings('li').removeClass('active'); }, "actions" : [ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", } { }, }, "disallowZeroCount" : "false", } ], "action" : "rerender" "action" : "rerender" } "context" : "envParam:entity", logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.Dialog.options['1035873562'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "event" : "AcceptSolutionAction", Die Mitnahme deiner Rufnummer belohnen wir übrigens mit einer Gutschrift von 10 € 212 Rufnummer mitbringen und 10 € sichern Gutschrift i.H.v. }; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "activecastFullscreen" : false, "triggerEvent" : "click", }, } { }, { { "action" : "rerender" } { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); return; { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ "showCountOnly" : "false", } "actions" : [ } { }, "action" : "addClassName" "actions" : [ // console.log(key); }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); setWarning(pagerId); "action" : "rerender" "action" : "rerender" }, { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "context" : "", }, } ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); return false; "kudosable" : "true", { }, } "initiatorBinding" : true, { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }); // Register the click event handler

Verdienst Adac Reisebüro, Theodor Fliedner Bedeutung Für Die Medizin Und Pflege, 76 Seen Im Salzkammergut Liste, Iegewies Eten & Drinken Callantsoog Niederlande, Landau Hessen Wandern, Grohe Alte Scheune, Ibb Dresden Oberschule, Ikea Schuhschrank Plastik, Kuchi Mitte Opentable, Hochgrat Webcam Bergfex, Tschechien Grenze Einkaufen Corona, Sommergespräche 2020 Kritik, Hund Im Wald Frei Laufen Lassen,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.